PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna27539.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 666aa    MW: 75162.4 Da    PI: 4.6074
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna27539.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.57.5e-51862132128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyat.gkrknratksgyWk 84 
                              +pGfrFhPtdeelv +yLk+k+ +kkl+l +vi+e+d+yk++P++Lp  + +k+++++w+fFs+rd+ky++ g r+nrat++gyWk
  mrna27539.1-v1.0-hybrid  86 QPGFRFHPTDEELVLYYLKRKICKKKLKL-NVIAETDVYKWDPEELPglSILKTGDRQWFFFSPRDRKYPNgGGRSNRATRHGYWK 170
                              69***************************.99***************644778899**************9678************ PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd+++++  ++ vglkktLvfykgrap+ge+tdWvmhey+l
  mrna27539.1-v1.0-hybrid 171 ATGKDRNITC-YNRSVGLKKTLVFYKGRAPTGERTDWVMHEYTL 213
                              **********.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-5679236IPR003441NAC domain
PROSITE profilePS5100553.67985236IPR003441NAC domain
PfamPF023651.8E-2787213IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MRLEAAFCAQ TNCSEGRPAC DDDRETVTTN CAERQRAKVG RHRRQPREEI WVPIEEIRGF  60
EFDLAESVMV SEDGLVSAFC DGHFWQPGFR FHPTDEELVL YYLKRKICKK KLKLNVIAET  120
DVYKWDPEEL PGLSILKTGD RQWFFFSPRD RKYPNGGGRS NRATRHGYWK ATGKDRNITC  180
YNRSVGLKKT LVFYKGRAPT GERTDWVMHE YTLDEEELKR CQNVQEYYAL YKVFKKSGPG  240
PKNGEQYGAP FREEDWADDE CPIINSSADR GISVEQIGEV VANYNAKPFG EVPLKQVEQI  300
TANGYANNNS EAHSTIDDLE EFMKQIADDA VLDLPQIDDL VHSLSQVVSE EETQSTVVDL  360
YSSEVKCPQS HTTFDPSGQQ GNEYASFDFT QSATSQTQLY EASEASASDV HKLESFTPIL  420
REEDFLEMDD LLGPEPTVSN TGNSGGNLQF NELDGFDLFQ DPAMFFNEMC PMDQGNVSHQ  480
FMNSMGSNVV NQFDYQIQPA PLQINHQLNQ ESTQINNQLW VQNERRDFYT STETTKGSGP  540
PFTSGVVHDS SNHCPQENPN QNGNEAAGVT SQFSSALWSF VESIPTTPAS ASENALVSRA  600
FERMSSFSRM RIIARSTNVP AGKDSETMRE SWKRGFFFLP VLVALCAIFW VLMASLGQWG  660
RCISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-458721317140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290458.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLM5W6F50.0M5W6F5_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-132NAC domain containing protein 17